Close Forward an order
By clicking this button, you can send a message to your purchasing manager to ask her/him to order this product. All information needed about our company and the product will be automatically attached. You will also have the opportunity to ask us for more information about the product. If so, your request will be forwarded to our technical service.


* Required Fields

Back to products list

AIFM1 / AIF antibody

AIFM1 / AIF antibody

If you want to order offline - tel: +33 (0) 437 654 230 - fax: +33 (0) 437 289 416

Ref : 00025969

* Required Fields

Product Code pab75157
Immunogen Human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA
Target Specificity Reacts with human AIFM1 / AIF. Cross reacts with mouse and rat protein.
Name AIFM1 / AIF
Accession Number O95831
Print datasheet
Product type Primary antibodies
Clonality Polyclonal antibody
Isotype IgG
Produced in Rabbit
Species Human, Mouse, Rat
Labelling None
Appearance Liquid
Form Purified
Constituents TBS, 50% glycerol, 0.5 mg/ml BSA
Preservatives 0.02% NaN3
Storage Short term 4°C, long term aliquot and store at -20°C, avoid freeze thaw cycles.
Applications Western Blot, IHC - Paraffin sections
Working dilutions IHC - P (5 µg/ml), WB
Print datasheet

AIFM1 / AIF antibody<br/>(pab75157)<br/>Anti-AIFM1 / AIF antibody IHC of human kidney, tubules. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5 µg/ml.

Newsletter Receive news, promotions and offers in your e-mail box